Arabidopsis thaliana (thale cress): AT4G35950 Help Entry AT4G35950         CDS       T00041                                  Symbol RAC6 Name (RefSeq) RAC-like 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04145   Phagosome ath04148   Efferocytosis ath04620   Toll-like receptor signaling pathway ath05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AT4G35950 (RAC6)    04148 Efferocytosis     AT4G35950 (RAC6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     AT4G35950 (RAC6)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     AT4G35950 (RAC6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT4G35950 (RAC6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ath04147]     AT4G35950 (RAC6)    04031 GTP-binding proteins [BR:ath04031]     AT4G35950 (RAC6) Membrane trafficking [BR:ath04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     AT4G35950 (RAC6)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     AT4G35950 (RAC6)   Macropinocytosis    Ras GTPases     AT4G35950 (RAC6)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     AT4G35950 (RAC6) Exosome [BR:ath04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AT4G35950 (RAC6)   Exosomal proteins of other body fluids (saliva and urine)    AT4G35950 (RAC6)   Exosomal proteins of colorectal cancer cells    AT4G35950 (RAC6)   Exosomal proteins of bladder cancer cells    AT4G35950 (RAC6) GTP-binding proteins [BR:ath04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     AT4G35950 (RAC6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  829750 NCBI-ProteinID:  NP_195320 TAIR:  AT4G35950 UniProt:  Q9SBJ6 A0A178UT65 Structure PDBPDBj LinkDB All DBs Position 4:complement(17023837..17025866) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL DLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQP PKQKKKKNKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatcaaggttcataaagtgcgtcaccgttggtgatggagctgttggtaaaacc tgtttgctgatttcttataccagcaacacctttcccacggattatgttccgactgttttc gataactttagtgcaaatgtggttgttaatggagccacggtgaatcttggattgtgggat actgcagggcaagaggactataacagattaagacctttgagttaccgtggtgctgatgtt ttcattcttgccttctctctcattagtaaggctagttatgagaatgtttccaagaagtgg attcctgagttgaagcactatgctcctggtgtcccaattgtccttgttggaaccaaacta gatcttcgagatgacaaacagtttttcatcgaccatcctggtgctgtccctattaccact gttcagggagaggagctgaagaagctaattggagcgccagcttacatcgagtgcagttca aaatcacaagagaacgtgaagggcgtgtttgatgcagcgatcagagtggtccttcaacct ccaaagcagaagaaaaagaagaacaaagcacaaaaggcctgctccatcttgtaa

DBGET integrated database retrieval system