Kmt5c (lysine methyltransferase 5C)

Advanced Search (OLGA)

Gene: Kmt5c (lysine methyltransferase 5C) Rattus norvegicus

Analyze

Symbol:

Kmt5c

Name:

lysine methyltransferase 5C

RGD ID:

1305226

Description:

Predicted to enable several functions, including S-adenosyl-L-methionine binding activity; histone H4K20 methyltransferase activity; and histone binding activity. Predicted to be involved in DNA repair; positive regulation of double-strand break repair via nonhomologous end joining; and positive regulation of isotype switching. Predicted to act upstream of or within chromatin remodeling. Predicted to be located in condensed chromosome, centromeric region; nucleoplasm; and pericentric heterochromatin. Predicted to be active in nucleus. Biomarker of liver benign neoplasm. Orthologous to human KMT5C (lysine methyltransferase 5C); PARTICIPATES IN histone modification pathway; lysine degradation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

[histone H4]-lysine20 N-methyltransferase KMT5B; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; histone-lysine N-methyltransferase KMT5C; histone-lysine N-methyltransferase SUV420H2; LOC308345; lysine (K)-specific methyltransferase 5C; lysine-specific methyltransferase 5C; su(var)4-20 homolog 2; suppressor of variegation 4-20 homolog 2; suppressor of variegation 4-20 homolog 2 (Drosophila); suv4-20h2; Suv420h2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KMT5C (lysine methyltransferase 5C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kmt5c (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kmt5c (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KMT5C (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KMT5C (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kmt5c (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KMT5C (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KMT5C (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kmt5c (lysine methyltransferase 5C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Kmt5c (lysine methyltransferase 5C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	KMT5C (lysine methyltransferase 5C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	set-4	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hmt4-20	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	kmt5c	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	78,128,325 - 78,135,931 (-)	NCBI		GRCr8
mRatBN7.2	1	69,099,531 - 69,107,145 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	69,099,539 - 69,107,145 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	74,444,576 - 74,452,182 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	83,008,879 - 83,016,485 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	76,157,538 - 76,165,177 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,666,662 - 72,674,271 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,666,665 - 72,674,271 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	75,861,337 - 75,868,946 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	67,815,981 - 67,823,611 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	67,894,088 - 67,899,997 (-)	NCBI
Celera	1	68,017,407 - 68,024,973 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Diabetes Mellitus (IEP)

liver benign neoplasm (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

fenthion (ISO)

folic acid (ISO)

furan (EXP)

glyphosate (EXP)

methidathion (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pirinixic acid (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

thioacetamide (EXP)

thiram (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

triticonazole (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA repair (ISO,ISS)

methylation (IEA)

positive regulation of double-strand break repair via nonhomologous end joining (ISO,ISS)

positive regulation of isotype switching (ISO,ISS)

Cellular Component

condensed chromosome, centromeric region (ISO)

heterochromatin (ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

pericentric heterochromatin (ISO)

Molecular Function

chromatin binding (ISO,ISS)

histone binding (ISO)

histone H4K20 methyltransferase activity (IBA,ISO,ISS)

histone H4K20 monomethyltransferase activity (IEA)

histone H4K20me methyltransferase activity (IEA)

metal ion binding (IEA)

protein binding (ISO)

S-adenosyl-L-methionine binding (ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

histone modification pathway (ISO)

lysine degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Histone lysine methylation dynamics: establishment, regulation, and biological impact.	Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Histone H3 lysine 9 and H4 lysine 20 trimethylation and the expression of Suv4-20h2 and Suv-39h1 histone methyltransferases in hepatocarcinogenesis induced by methyl deficiency in rats.	Pogribny IP, etal., Carcinogenesis. 2006 Jun;27(6):1180-6. Epub 2006 Feb 23.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Epigenetic changes in mitochondrial superoxide dismutase in the retina and the development of diabetic retinopathy.	Zhong Q and Kowluru RA, Diabetes. 2011 Apr;60(4):1304-13. doi: 10.2337/db10-0133. Epub 2011 Feb 25.

Additional References at PubMed

PMID:15145825	PMID:17182829	PMID:19486527	PMID:24049080	PMID:24396869	PMID:25335925	PMID:28114273

Genomics

Comparative Map Data

Kmt5c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	78,128,325 - 78,135,931 (-)	NCBI		GRCr8
mRatBN7.2	1	69,099,531 - 69,107,145 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	69,099,539 - 69,107,145 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	74,444,576 - 74,452,182 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	83,008,879 - 83,016,485 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	76,157,538 - 76,165,177 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,666,662 - 72,674,271 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,666,665 - 72,674,271 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	75,861,337 - 75,868,946 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	67,815,981 - 67,823,611 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	67,894,088 - 67,899,997 (-)	NCBI
Celera	1	68,017,407 - 68,024,973 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

KMT5C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	55,339,876 - 55,348,121 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	55,339,853 - 55,348,121 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	55,851,244 - 55,859,489 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	60,543,076 - 60,551,301 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	60,543,075 - 60,551,300	NCBI
Celera	19	52,892,173 - 52,900,453 (+)	NCBI		Celera
Cytogenetic Map	19	q13.42	NCBI
HuRef	19	52,173,507 - 52,181,789 (+)	NCBI		HuRef
CHM1_1	19	55,845,041 - 55,853,309 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	58,435,095 - 58,443,627 (+)	NCBI		T2T-CHM13v2.0

Kmt5c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	4,743,091 - 4,750,513 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	4,743,114 - 4,750,513 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	4,740,092 - 4,747,514 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	4,740,115 - 4,747,514 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	4,691,729 - 4,699,116 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	4,343,275 - 4,350,574 (+)	NCBI		MGSCv36	mm8
Celera	7	4,470,199 - 4,477,587 (+)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	2.74	NCBI

Kmt5c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955567	894,608 - 900,578 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955567	895,334 - 901,240 (-)	NCBI	ChiLan1.0	ChiLan1.0

KMT5C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	61,476,795 - 61,485,754 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	63,205,884 - 63,214,838 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	52,381,963 - 52,390,507 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	61,073,185 - 61,079,389 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	61,073,396 - 61,078,717 (+)	Ensembl	panpan1.1		panPan2

KMT5C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	102,334,687 - 102,342,090 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	102,333,543 - 102,342,118 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	102,391,254 - 102,398,667 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	102,987,756 - 102,995,170 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	102,986,612 - 102,995,188 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	102,625,010 - 102,632,419 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	102,337,091 - 102,344,516 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	103,100,299 - 103,107,712 (-)	NCBI		UU_Cfam_GSD_1.0

Kmt5c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	1,956,266 - 1,963,342 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936886	595,782 - 604,286 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936886	596,949 - 602,959 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KMT5C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	59,517,098 - 59,524,550 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	59,517,058 - 59,524,551 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KMT5C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	47,942,100 - 47,950,364 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	47,944,197 - 47,949,693 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	576,523 - 584,848 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kmt5c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	1,945,193 - 1,951,247 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	1,945,194 - 1,951,016 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Kmt5c
28 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	73
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000023744
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

BE107946

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	69,099,441 - 69,099,656 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,666,568 - 72,666,782	NCBI	Rnor6.0
Rnor_5.0	1	75,868,826 - 75,869,040	UniSTS	Rnor5.0
RGSC_v3.4	1	67,815,884 - 67,816,098	UniSTS	RGSC3.4
Celera	1	68,024,856 - 68,025,070	UniSTS
Cytogenetic Map	1	q12	UniSTS

BF396701

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	69,103,071 - 69,103,271 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,670,198 - 72,670,397	NCBI	Rnor6.0
Rnor_5.0	1	75,865,211 - 75,865,410	UniSTS	Rnor5.0
RGSC_v3.4	1	67,819,514 - 67,819,713	UniSTS	RGSC3.4
Celera	1	68,021,244 - 68,021,443	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006228264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY724526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023744 ⟹ ENSRNOP00000023744

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	69,099,539 - 69,107,145 (-)	Ensembl
Rnor_6.0 Ensembl	1	72,666,665 - 72,674,271 (-)	Ensembl

RefSeq Acc Id:

NM_001107475 ⟹ NP_001100945

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	78,128,325 - 78,135,931 (-)	NCBI
mRatBN7.2	1	69,099,539 - 69,107,145 (-)	NCBI
Rnor_6.0	1	72,666,665 - 72,674,271 (-)	NCBI
Rnor_5.0	1	75,861,337 - 75,868,946 (+)	NCBI
RGSC_v3.4	1	67,815,981 - 67,823,611 (-)	RGD
Celera	1	68,017,407 - 68,024,973 (+)	RGD

Sequence:

show sequence

GGTTGAGTTGTCTGTCTTTCCGGCCGAGGGGAGGCGCGGCGGCTGTATCTGACGAGAGCCGGAG
GAGGCGGTGGGTGGAGGTGGCGGCTGCAACGCGGGCGCCGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGAAGGAGGAGGAGAAGCGGGAGTTCCCCCAAACCCTGCTTGGAACCGCTAAGCCCT
TCCCTTGGACCCTGGGCGTATGTACCCTTTGGATTTCGTGGTCTCCTCCCTTGCAACCGCAGAT
AAGCAGGCTCTGGGGCCCACAGACATCCCATGTAGCTTCTGAGTGGCATATCCATGTGCCCTGT
TCTGTGCCAGAAGCAGCATGGTTTATAGAGCACCATGGGGCCTGACCGAGTGACAGCCCGAGAA
CTGTGCGAGAATGATGACCTGGCCACCAGCCTTGTTCTTGACCCCTACCTCGGCTTCCGCACCC
ATAAGATGAATGTCAGCCCTGTGCCCACCCTCCGACGACAACACCACCTTCGCTCAGCACTGGA
AGCTTTCCTAAGGCAACGGGACCTGGAAGCTGCATTCCGGGCCCTGACACTGGGAGGCTGGATG
GCCCACTACTTTCAGAACCGTGCTCCTCGGCAGGAGGCTGCCCTCAAGAACCACATTTTTTGCT
ACCTCCGCGCCTTCCTGCCTGAGAGTGGCTTCACCATTCTGCCCTGCACCCGCTACTCCATGGA
GACCAATGGGGCCAAGATTGTGTCTACCCGTGCTTGGAAGAAGAATGAGAAGCTGGAGCTGCTG
GTGGGCTGCATTGCAGAGCTGCGGGAAGAGGATGAATACCTACTTAGGGCAGGCGAGAACGACT
TCAGCGTCATGTACTCCACTCGAAAAAGGAGTGCCCAGCTGTGGCTTGGCCCAGCTGCCTTTAT
CAACCATGACTGCAAACCCAACTGCAAGTTTGTGCCCTCAGATGGAAATACTGCCTGTGTGAAG
GTGCTACGGGACATTGAGCCGGGGGATGAAGTAACTTGCTTCTATGGCGAGGGCTTCTTCGGTG
AGAAGAATGAGCACTGTGAATGCTATACCTGTGAGAGGAAAGGCGAGGGAGCTTTCAGACTTCA
GCCCAGGGAGCCGGAGCTGAGGCCACGGCCCCTGGACAAGTATGAGCTCCGAGAGACAAAGAGG
CGTCTGCAGCAGTGTTTGGACAGCAGCCAGCAGAACCTGCTGAGCCTGCGGGCCTGCTCCCACC
TGTCCCCACTGCGCCCTGACCCATTCTGTGCTGCCTGCCAGCCCTCATGCCTGCTGCCTGTCAG
TCCCCACATGGACTACTTGCCCCTCTGGCTCCAGTGGGTGCCTCAGCCCCAGCCCAGAGTACGT
CCCCGGAAGCGCCGCCGTCGCCGCCGCCGTCGCCCCAGGATACCCCAGGCTTCATTGTCCCCTG
ACCTGCACACTGCCTGTGTATCCCTACACCGATGGGGAGGCTGTGGTCCCCACTGCCAACTACG
GGCTGAGGCCATGGTGACCCTACACCTGCTCCCCCAGACTCGCTGGACCCCAAAACAGGACTGG
TACTGGGCCCGACGCTATGGGCTACCTTCTGTGGTGCGCGTTGAACTTTCCCCTCTAGCCCCAG
CCCTACCAGCTGCTCCTGCTCCTGCTGGGAACCTAGGTCCCACCCCCACCCCTGACCTCATACC
TAAACAGGCCCTTGCCTTCGCTCCTTTCTGCCCACCTAAGCGCCTCCGGCTAGTGGTCAGCCAT
GGTTCTATTGATCTGGACATCAATAGTGGTGAGCCATGATGGGCTGCTTACAGGGAGCCCTGAA
TGGAAGGTAGAGTCTCTGTCTTGGACCCCTCCAGAAGGGAAAGAGGAAACTGACCCTTAACCCA
GGTCTGATCTTGGGAGTGTGTTGTTGGGGACATCCCTAGAGAGTTTGATCCTTGTTGCTCTATG
GTTGCTGACCCCTGAGCCAGCCCCAACTCAGCAGGGAGCCCTGGCCATTTGATGTCCCCATCCC
TGTCCCTGCCCCCACCTCAGGACTGTAGGAGTCATTCCCCTCCCCTCAGCCTCTTCCTCCCCAG
GGAGCAAAGCCATAGGGGTTGGGGGCCACTCCATGGCAACTCTCCAGAAGGCCAGGCCTCAGGA
GGTGGAATTGACTTGGGGGTTTGCCTTCCCAAACTACTCCCAGAGTGGGGAGTAAGTTGGCGCT
CAGCTCTGCAGTTGATGGAGGTACGGGCTGTCAGATGGGGTGGGTTGTACCCAGGGACACAACC
TTGGCTCTGAACATGGGTCTCAGGGAGGCCAGGTGTGACCTCATCTTTTTCACGGTGCTATCCC
TGGTGCTACTGGGGTGTAGGGGAGGCTCCCTCTCCTCCCCACACCAGAATGGGGTATGATGGGG
GATTGGAAGAACTTGAACTTTTTATTAAAACATTGTAAGCCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100945	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75851	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023744.5
	ENSRNOP00055020174
	ENSRNOP00060038235
	ENSRNOP00065045786
GenBank Protein	P0C2N6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001100945 ⟸ NM_001107475

- UniProtKB:

P0C2N6 (UniProtKB/Swiss-Prot), A6KNN2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPTLRRQHHLRSALEAFLRQRDLEAA
FRALTLGGWMAHYFQNRAPRQEAALKNHIFCYLRAFLPESGFTILPCTRYSMETNGAKIVSTRA
WKKNEKLELLVGCIAELREEDEYLLRAGENDFSVMYSTRKRSAQLWLGPAAFINHDCKPNCKFV
PSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEGAFRLQPREPELRPRPL
DKYELRETKRRLQQCLDSSQQNLLSLRACSHLSPLRPDPFCAACQPSCLLPVSPHMDYLPLWLQ
WVPQPQPRVRPRKRRRRRRRRPRIPQASLSPDLHTACVSLHRWGGCGPHCQLRAEAMVTLHLLP
QTRWTPKQDWYWARRYGLPSVVRVELSPLAPALPAAPAPAGNLGPTPTPDLIPKQALAFAPFCP
PKRLRLVVSHGSIDLDINSGEP

hide sequence

Ensembl Acc Id:

ENSRNOP00000023744 ⟸ ENSRNOT00000023744

Protein Domains

SET

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P0C2N6-F1-model_v2	AlphaFold	P0C2N6	1-470	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689699

Promoter ID:

EPDNEW_R224

Type:

single initiation site

Name:

Kmt5c_1

Description:

lysine methyltransferase 5C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	72,674,227 - 72,674,287	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305226	AgrOrtholog
BioCyc Gene	G2FUF-60856	BioCyc
Ensembl Genes	ENSRNOG00000017508	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055014386	UniProtKB/Swiss-Prot
	ENSRNOG00060026588	UniProtKB/Swiss-Prot
	ENSRNOG00065032308	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023744.6	UniProtKB/Swiss-Prot
	ENSRNOT00055024693	UniProtKB/Swiss-Prot
	ENSRNOT00060046045	UniProtKB/Swiss-Prot
	ENSRNOT00065055620	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.1700	UniProtKB/Swiss-Prot
	2.170.270.10	UniProtKB/Swiss-Prot
	Histone-lysine N-methyltransferase	UniProtKB/TrEMBL
	SET domain	UniProtKB/TrEMBL
InterPro	Hist-Lys_N-MTase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hist-Lys_N-MTase_Suvar4-20	UniProtKB/Swiss-Prot
	KMT5B/KMT5C/SET9	UniProtKB/Swiss-Prot
	KMT5C_SET	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SET_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SET_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Suv4-20/Set9	UniProtKB/TrEMBL
	Suv4-20_animal	UniProtKB/TrEMBL
KEGG Report	rno:308345	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	308345	ENTREZGENE
PANTHER	HISTONE-LYSINE N-METHYLTRANSFERASE KMT5C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12977	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SET	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Kmt5c	PhenoGen
PROSITE	SAM_MT43_SUVAR420_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SET	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017508	RatGTEx
	ENSRNOG00055014386	RatGTEx
	ENSRNOG00060026588	RatGTEx
	ENSRNOG00065032308	RatGTEx
SMART	SET	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SET domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6KNN2	ENTREZGENE, UniProtKB/TrEMBL
	KMT5C_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Kmt5c	lysine methyltransferase 5C	Kmt5c	lysine (K)-specific methyltransferase 5C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-12	Kmt5c	lysine (K)-specific methyltransferase 5C	Suv420h2	suppressor of variegation 4-20 homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Suv420h2	suppressor of variegation 4-20 homolog 2 (Drosophila)	Suv420h2_predicted	suppressor of variegation 4-20 homolog 2 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Suv420h2_predicted	suppressor of variegation 4-20 homolog 2 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)