Eef1akmt1 (EEF1A lysine methyltransferase 1)

Advanced Search (OLGA)

Gene: Eef1akmt1 (EEF1A lysine methyltransferase 1) Rattus norvegicus

Analyze

Symbol:

Eef1akmt1

Name:

EEF1A lysine methyltransferase 1

RGD ID:

1306762

Description:

Predicted to enable protein-lysine N-methyltransferase activity. Predicted to be involved in peptidyl-lysine methylation. Predicted to be located in cytoplasm. Orthologous to human EEF1AKMT1 (EEF1A lysine methyltransferase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; LOC290279; MGC188401; N(6)-adenine-specific DNA methyltransferase 2; N-6 adenine-specific DNA methyltransferase 2 (putative); N6amt2; protein-lysine N-methyltransferase N6AMT2; RGD1306762; similar to RIKEN cDNA 2510005D08

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EEF1AKMT1 (EEF1A lysine methyltransferase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Eef1akmt1 (EEF1A alpha lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Eef1akmt1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EEF1AKMT1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EEF1AKMT1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Eef1akmt1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	XPO4 (exportin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EEF1AKMT1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Eef1akmt1 (EEF1A lysine methyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Eef1akmt1 (EEF1A alpha lysine methyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	EEF1AKMT1 (EEF1A lysine methyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	EFM5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9154	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	M142.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	eef1akmt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	eef1akmt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	35,809,842 - 35,826,921 (-)	NCBI		GRCr8
mRatBN7.2	15	31,694,284 - 31,711,367 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	31,694,292 - 31,711,336 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	33,685,599 - 33,702,678 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	34,836,283 - 34,853,362 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	33,094,363 - 33,111,443 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	37,813,115 - 37,830,932 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	37,813,115 - 37,831,031 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	41,658,536 - 41,680,058 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	36,589,142 - 36,602,237 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	36,604,841 - 36,616,940 (-)	NCBI
Celera	15	31,405,022 - 31,418,117 (-)	NCBI		Celera
Cytogenetic Map	15	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness 3B (ISO)

autosomal recessive nonsyndromic deafness 1A (ISO)

autosomal recessive nonsyndromic deafness 1B (ISO)

cataract 14 multiple types (ISO)

Clouston syndrome (ISO)

ectodermal dysplasia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzoates (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

gentamycin (EXP)

indometacin (ISO)

isoprenaline (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

methylation (IEA)

peptidyl-lysine methylation (ISO)

Cellular Component

cytoplasm (IEA)

Molecular Function

methyltransferase activity (ISO)

nucleic acid binding (IEA)

protein-lysine N-methyltransferase activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15632090	PMID:23376485	PMID:26545399

Genomics

Comparative Map Data

Eef1akmt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	35,809,842 - 35,826,921 (-)	NCBI		GRCr8
mRatBN7.2	15	31,694,284 - 31,711,367 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	31,694,292 - 31,711,336 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	33,685,599 - 33,702,678 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	34,836,283 - 34,853,362 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	33,094,363 - 33,111,443 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	37,813,115 - 37,830,932 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	37,813,115 - 37,831,031 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	41,658,536 - 41,680,058 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	36,589,142 - 36,602,237 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	36,604,841 - 36,616,940 (-)	NCBI
Celera	15	31,405,022 - 31,418,117 (-)	NCBI		Celera
Cytogenetic Map	15	p12	NCBI

EEF1AKMT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	20,728,731 - 20,773,961 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	20,728,731 - 20,773,961 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	21,302,870 - 21,348,100 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	20,201,070 - 20,246,057 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	2,365,009 - 2,409,998 (-)	NCBI		Celera
Cytogenetic Map	13	q12.11	NCBI
HuRef	13	2,106,193 - 2,151,141 (-)	NCBI		HuRef
CHM1_1	13	21,271,160 - 21,316,199 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	19,921,875 - 19,967,105 (-)	NCBI		T2T-CHM13v2.0

Eef1akmt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	57,787,052 - 57,809,039 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	57,787,054 - 57,809,069 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	57,549,595 - 57,571,582 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	57,549,597 - 57,571,612 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	58,168,435 - 58,190,406 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	56,503,708 - 56,525,679 (-)	NCBI		MGSCv36	mm8
Celera	14	55,347,598 - 55,372,810 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	30.1	NCBI

Eef1akmt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955497	1,506,742 - 1,521,850 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955497	1,509,855 - 1,540,786 (-)	NCBI	ChiLan1.0	ChiLan1.0

EEF1AKMT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	20,358,932 - 20,406,363 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	11,472,101 - 11,521,986 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	2,049,642 - 2,100,864 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	20,368,837 - 20,413,832 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	20,367,809 - 20,413,836 (-)	Ensembl	panpan1.1		panPan2

EEF1AKMT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	17,357,251 - 17,382,098 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	17,357,328 - 17,381,821 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	17,388,433 - 17,413,630 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	17,495,456 - 17,520,656 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	17,496,208 - 17,522,168 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	17,366,723 - 17,391,679 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	17,378,122 - 17,403,284 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	17,434,884 - 17,460,096 (+)	NCBI		UU_Cfam_GSD_1.0

Eef1akmt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	119,406,978 - 119,450,928 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936720	954,556 - 998,487 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936720	954,450 - 998,483 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

XPO4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	1,067,061 - 1,082,591 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	1,054,816 - 1,095,118 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	192,862 - 220,306 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EEF1AKMT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	352,063 - 418,220 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	352,114 - 395,586 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666057	44,162,212 - 44,251,990 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eef1akmt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624776	16,903,531 - 16,921,896 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624776	16,875,625 - 16,918,153 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Eef1akmt1
33 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	87
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000064702
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

RH129072

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	31,694,332 - 31,694,502 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	37,813,160 - 37,813,329	NCBI	Rnor6.0
Rnor_5.0	15	41,658,596 - 41,658,765	UniSTS	Rnor5.0
RGSC_v3.4	15	36,589,186 - 36,589,355	UniSTS	RGSC3.4
Celera	15	31,405,066 - 31,405,235	UniSTS
Cytogenetic Map	15	p12	UniSTS

BM389868

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	31,709,767 - 31,709,969 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	37,828,590 - 37,828,792	NCBI	Rnor6.0
Rnor_5.0	15	41,674,026 - 41,674,228	UniSTS	Rnor5.0
RGSC_v3.4	15	36,604,616 - 36,604,818	UniSTS	RGSC3.4
Celera	15	31,420,496 - 31,420,698	UniSTS
RH 3.4 Map	15	213.68	UniSTS
Cytogenetic Map	15	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001393822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064702 ⟹ ENSRNOP00000059566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	31,694,292 - 31,711,336 (-)	Ensembl
Rnor_6.0 Ensembl	15	37,813,117 - 37,826,211 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075861 ⟹ ENSRNOP00000068470

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	31,694,294 - 31,711,308 (-)	Ensembl
Rnor_6.0 Ensembl	15	37,813,116 - 37,830,131 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075884 ⟹ ENSRNOP00000068357

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	31,695,285 - 31,711,290 (-)	Ensembl
Rnor_6.0 Ensembl	15	37,814,112 - 37,830,113 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091562 ⟹ ENSRNOP00000075559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	37,813,115 - 37,831,031 (-)	Ensembl

RefSeq Acc Id:

NM_001134990 ⟹ NP_001128462

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	35,809,842 - 35,826,921 (-)	NCBI
mRatBN7.2	15	31,694,284 - 31,711,367 (-)	NCBI
Rnor_6.0	15	37,813,116 - 37,826,211 (-)	NCBI
Rnor_5.0	15	41,658,536 - 41,680,058 (-)	NCBI
RGSC_v3.4	15	36,589,142 - 36,602,237 (-)	RGD
Celera	15	31,405,022 - 31,418,117 (-)	RGD

Sequence:

show sequence

CAAGAACCTCCGTAAAACATGGAGAAAGCGCACCAAGGCAGAAATAAATAGGAAAAACACCTGA
AAGCCCTCTAGGAAGGAAAGAGAGAGAAGAATATGAGAGAGCTTTTATTAGAGCTCATCCTGTG
TTCACACGGACATAGGCGTGGCACCACGCATGTGCGAAGGTCGCAGACACCTTGTGAAATGAGC
GATTCAGAAGACGATGACATACCCCAGCTTTCTTCCCACACCTTAGCAGCTCTGCAGGAGTTTT
ATGCTGAGCAGAAGCAAACCATCAACCCAGGAGGGGATGATAAATACAACGTTGGGGTGATAGA
GGAGAACTGGCAGCTGAGCCAGTTCTGGTACAGTCAGGACACTGCTTTGAGACTTGCACAGGAA
GCCATCAATGCTGTGGGAGAAGGCGGCAGAATTGCATGTGTGAGCGCACCCAGTGTGTACCAGA
AGCTCCGGGAGCTTCGTAGGGAAGACATCTCTGTATACATCTTTGAATACGACAGAAGATTCGC
CATATATGGGGATGAGTTTATCTTCTATGACTACAATAATCCACTGGACTTGCCTGAGGGAGTC
GCCCCGCATAGCTTTGACATTGTGGTTGCAGACCCTCCTTACCTGTCTGAGGAGTGTCTCAGGA
AGACATCCGAAACCATCCAGTTCCTGACTCAGGGCAAGATTCTGCTGTGCACAGGCGCCATCAT
GGAGGAGCAGGCAGCTCAGCTCCTGGGTGTGAAGGTGTGCAAGTTTATTCCAGAACATTCCCGA
AACTTGGCCAATGAGTTCCGCTGTTATACGAACTATGACTCCGGGCTGGACTGTGAAACCTAGA
GTCACATGACAGCAGTTCCAGTGAGGGCCCCACATCCATTTCCCAGTTCTCTTCCTGTTGAACG
TCGTGACCTCTCCCTCGCTCTGCCACGACTGGGACTCCCATGGCTTATTTTTCAAAATAAAATA
AAACTTCTCATTGCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001393822 ⟹ NP_001380751

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	35,809,842 - 35,826,921 (-)	NCBI
mRatBN7.2	15	31,694,284 - 31,711,367 (-)	NCBI

RefSeq Acc Id:

XM_039093139 ⟹ XP_038949067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	35,809,847 - 35,821,921 (-)	NCBI
mRatBN7.2	15	31,694,289 - 31,706,385 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001128462	(Get FASTA)	NCBI Sequence Viewer
	NP_001380751	(Get FASTA)	NCBI Sequence Viewer
	XP_038949067	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68660	(Get FASTA)	NCBI Sequence Viewer
	EDM14351	(Get FASTA)	NCBI Sequence Viewer
	EDM14352	(Get FASTA)	NCBI Sequence Viewer
	EDM14353	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059566.2
	ENSRNOP00000068357.1
	ENSRNOP00000068470.2

RefSeq Acc Id:

NP_001128462 ⟸ NM_001134990

- UniProtKB:

B5DEG5 (UniProtKB/TrEMBL), A0A096MKD1 (UniProtKB/TrEMBL), F7FGJ4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDSEDDDIPQLSSHTLAALQEFYAEQKQTINPGGDDKYNVGVIEENWQLSQFWYSQDTALRLA
QEAINAVGEGGRIACVSAPSVYQKLRELRREDISVYIFEYDRRFAIYGDEFIFYDYNNPLDLPE
GVAPHSFDIVVADPPYLSEECLRKTSETIQFLTQGKILLCTGAIMEEQAAQLLGVKVCKFIPEH
SRNLANEFRCYTNYDSGLDCET

hide sequence

Ensembl Acc Id:

ENSRNOP00000068357 ⟸ ENSRNOT00000075884

Ensembl Acc Id:

ENSRNOP00000068470 ⟸ ENSRNOT00000075861

Ensembl Acc Id:

ENSRNOP00000075559 ⟸ ENSRNOT00000091562

Ensembl Acc Id:

ENSRNOP00000059566 ⟸ ENSRNOT00000064702

RefSeq Acc Id:	XP_038949067 ⟸ XM_039093139
- Peptide Label:	isoform X1

RefSeq Acc Id:	NP_001380751 ⟸ NM_001393822
- UniProtKB:	B5DEG5 (UniProtKB/TrEMBL), A0A096MKD1 (UniProtKB/TrEMBL), F7FGJ4 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2KAX1-F1-model_v2	AlphaFold	A0A0G2KAX1	1-224	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699729

Promoter ID:

EPDNEW_R10245

Type:

multiple initiation site

Name:

Eef1akmt1_1

Description:

EEF1A lysine methyltransferase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	37,830,117 - 37,830,177	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306762	AgrOrtholog
BioCyc Gene	G2FUF-13601	BioCyc
Ensembl Genes	ENSRNOG00000009849	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064702.4	UniProtKB/TrEMBL
	ENSRNOT00000075861.3	UniProtKB/TrEMBL
	ENSRNOT00000075884.2	UniProtKB/TrEMBL
InterPro	DNA_methylase_N6_adenine_CS	UniProtKB/TrEMBL
	N6-adenineMlase	UniProtKB/TrEMBL
	N6_adenine_Mtase-rel_euk	UniProtKB/TrEMBL
	SAM-dependent_MTases-like	UniProtKB/TrEMBL
KEGG Report	rno:290279	UniProtKB/TrEMBL
NCBI Gene	290279	ENTREZGENE
PANTHER	EEF1A LYSINE METHYLTRANSFERASE 1	UniProtKB/TrEMBL
	PTHR13200	UniProtKB/TrEMBL
Pfam	N6-adenineMlase	UniProtKB/TrEMBL
PhenoGen	Eef1akmt1	PhenoGen
PROSITE	N6_MTASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009849	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/TrEMBL
UniProt	A0A096MK28_RAT	UniProtKB/TrEMBL
	A0A096MKD1	ENTREZGENE, UniProtKB/TrEMBL
	B5DEG5	ENTREZGENE, UniProtKB/TrEMBL
	F7FGJ4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-02	Eef1akmt1	EEF1A lysine methyltransferase 1	Eef1akmt1	eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-25	Eef1akmt1	eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1	N6amt2	N-6 adenine-specific DNA methyltransferase 2 (putative)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	N6amt2	N-6 adenine-specific DNA methyltransferase 2 (putative)	RGD1306762_predicted	similar to RIKEN cDNA 2510005D08 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1306762_predicted	similar to RIKEN cDNA 2510005D08 (predicted)	LOC290279_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290279_predicted	similar to RIKEN cDNA 2510005D08 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar