Myod1 (myogenic differentiation 1)

Advanced Search (OLGA)

Gene: Myod1 (myogenic differentiation 1) Mus musculus

Analyze

Symbol:

Myod1

Name:

myogenic differentiation 1

RGD ID:

1332500

MGI Page

MGI

Description:

Enables several functions, including DNA binding activity; DNA-binding transcription activator activity, RNA polymerase II-specific; and DNA-binding transcription factor binding activity. Contributes to DNA binding activity. Involved in several processes, including cellular response to estradiol stimulus; positive regulation of snRNA transcription by RNA polymerase II; and skeletal muscle cell differentiation. Acts upstream of or within several processes, including myotube differentiation; regulation of RNA metabolic process; and skeletal muscle fiber adaptation. Located in euchromatin; myofibril; and nucleus. Part of transcription regulator complex. Is expressed in several structures, including alimentary system; embryo mesenchyme; limb; limb bud; and skeletal musculature. Human ortholog(s) of this gene implicated in congenital myopathy 17. Orthologous to human MYOD1 (myogenic differentiation 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AI503393; bHLHc; bHLHc1; MYF3; Myo; myoblast determination protein 1; MyoD; Myod-; Myod-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYOD1 (myogenic differentiation 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103239432 (myoblast determination protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Myod1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MYOD1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	myod1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	hlh-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nau	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	myod1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	46,025,898 - 46,028,523 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	46,376,474 - 46,379,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	53,631,844 - 53,634,462 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	46,244,524 - 46,247,137 (+)	NCBI		MGSCv36	mm8
Celera	7	41,849,969 - 41,852,587 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	30.03	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant centronuclear myopathy (ISO)

congenital diaphragmatic hernia (ISO)

congenital myopathy 17 (ISO)

congenital structural myopathy (ISO)

congestive heart failure (ISO)

Diaphragmatic Hernia (ISO)

embryonal rhabdomyosarcoma (ISO)

Experimental Arthritis (ISO)

hypertension (ISO)

intellectual disability (ISO)

obesity (ISO)

Prenatal Exposure Delayed Effects (ISO)

progressive myoclonus epilepsy 7 (ISO)

Skeletal Muscle Injuries (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(S)-naringenin (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

28-Homobrassinolide (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (EXP)

5-azacytidine (EXP,ISO)

5-fluorouracil (EXP)

7,12-dimethyltetraphene (ISO)

acetic acid (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP)

alpha-Zearalanol (ISO)

ammonium chloride (ISO)

antimycin A (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

boric acid (ISO)

Botulinum toxin type A (ISO)

bromochloroacetic acid (EXP)

bupivacaine (ISO)

butanal (ISO)

carmustine (ISO)

chromium atom (ISO)

dexamethasone (EXP)

diacetylmonoxime (EXP)

dimethylarsinous acid (EXP)

genistein (ISO)

indinavir (EXP)

indoxyl sulfate (EXP)

isotretinoin (ISO)

lamivudine (EXP)

latrunculin B (EXP)

lead diacetate (EXP)

leflunomide (EXP)

ML-7 (EXP)

niclosamide (EXP)

nitrofen (ISO)

perfluorooctanoic acid (ISO)

Ptaquiloside (EXP)

quercetin (ISO)

raloxifene (ISO)

resveratrol (EXP,ISO)

salubrinal (EXP)

saquinavir (EXP)

SB 203580 (EXP)

sirolimus (EXP)

sodium arsenite (EXP)

spermine (EXP)

tamoxifen (ISO)

testosterone (EXP)

theaflavin (EXP)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (EXP)

trichloroethene (ISO)

valproic acid (EXP)

zidovudine (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle cell differentiation (NAS)

cellular response to estradiol stimulus (IDA)

cellular response to glucocorticoid stimulus (IDA)

cellular response to oxygen levels (IDA)

cellular response to starvation (IDA)

cellular response to tumor necrosis factor (IDA)

muscle cell differentiation (IDA)

muscle organ development (IDA,IGI)

myoblast differentiation (IDA)

myoblast fate determination (IDA)

myoblast fusion (IMP)

myotube cell development (ISO)

myotube differentiation (IDA)

myotube differentiation involved in skeletal muscle regeneration (IMP)

negative regulation of myoblast proliferation (IMP)

positive regulation of DNA-templated transcription (IDA)

positive regulation of muscle cell differentiation (IDA,ISO)

positive regulation of myoblast differentiation (IBA)

positive regulation of myoblast fusion (IEA,ISO)

positive regulation of skeletal muscle fiber development (IBA)

positive regulation of skeletal muscle tissue regeneration (IMP)

positive regulation of snRNA transcription by RNA polymerase II (IMP)

positive regulation of transcription by RNA polymerase II (IDA,IGI,IMP,ISO)

regulation of alternative mRNA splicing, via spliceosome (IDA,IMP)

regulation of gene expression (IDA)

regulation of RNA splicing (ISO)

regulation of transcription by RNA polymerase II (IBA,IDA)

response to muscle stretch (ISO)

skeletal muscle atrophy (ISO)

skeletal muscle cell differentiation (IBA,IDA,IMP,NAS)

skeletal muscle fiber adaptation (IMP)

skeletal muscle fiber development (IMP)

skeletal muscle tissue development (IDA,IGI,IMP,TAS)

skeletal muscle tissue regeneration (IDA,IMP,ISO)

striated muscle cell differentiation (IMP)

transcription by RNA polymerase II (IGI)

Cellular Component

chromatin (IDA)

cytoplasm (IDA)

euchromatin (IDA)

myofibril (IDA)

nucleoplasm (ISO,TAS)

nucleus (IDA,TAS)

transcription regulator complex (IDA)

Molecular Function

bHLH transcription factor binding (IPI)

chromatin binding (IDA)

chromatin DNA binding (IDA)

cis-regulatory region sequence-specific DNA binding (IDA)

DNA binding (IDA)

DNA-binding transcription activator activity (IDA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IC,IDA,IMP,ISO)

DNA-binding transcription factor activity (IDA,IMP)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,TAS)

E-box binding (IDA,ISO)

enzyme binding (IPI)

nuclear receptor binding (IEA,ISO)

promoter-specific chromatin binding (IDA)

protein binding (IPI)

protein homodimerization activity (IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IPI)

sequence-specific DNA binding (IDA)

sequence-specific double-stranded DNA binding (ISO)

ubiquitin protein ligase binding (IPI)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal adipose tissue distribution (IAGP)

abnormal heart ventricle morphology (IAGP)

abnormal muscle development (IAGP)

abnormal muscle morphology (IAGP)

abnormal muscle physiology (IAGP)

abnormal myogenesis (IAGP)

abnormal myotube morphology (IAGP)

abnormal rib morphology (IAGP)

absent skeletal muscle (IAGP)

cardiac fibrosis (IAGP)

cardiac interstitial fibrosis (IAGP)

centrally nucleated skeletal muscle fibers (IAGP)

decreased body size (IAGP)

decreased fetal size (IAGP)

decreased litter size (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

decreased satellite cell number (IAGP)

decreased skeletal muscle fiber number (IAGP)

delayed skeletal muscle regeneration (IAGP)

dilated cardiomyopathy (IAGP)

increased heart weight (IAGP)

increased myocardial fiber size (IAGP)

increased sarcoma incidence (IAGP)

increased satellite cell number (IAGP)

increased tumor incidence (IAGP)

kyphosis (IAGP)

muscle hypoplasia (IAGP)

myocardium necrosis (IAGP)

neonatal lethality, complete penetrance (IAGP)

no abnormal phenotype detected (IAGP)

postnatal lethality (IAGP)

postnatal lethality, complete penetrance (IAGP)

premature death (IAGP)

respiratory failure (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Fenofibrate administration to arthritic rats increases adiponectin and leptin and prevents oxidative muscle wasting.	Castillero E, etal., Endocr Connect. 2012 Jun 8;1(1):1-12. doi: 10.1530/EC-12-0003. Print 2012 Jul 1.
2.	The role of primary myogenic regulatory factors in the developing diaphragmatic muscle in the nitrofen-induced diaphragmatic hernia.	Dingemann J, etal., Pediatr Surg Int. 2011 Jun;27(6):579-82. doi: 10.1007/s00383-010-2834-8.
3.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
4.	MGDs mouse GO annotations	MGD data from the GO Consortium
5.	MGD IEA	MGD IEA
6.	Age-associated disruption of molecular clock expression in skeletal muscle of the spontaneously hypertensive rat.	Miyazaki M, etal., PLoS One. 2011;6(11):e27168. doi: 10.1371/journal.pone.0027168. Epub 2011 Nov 4.
7.	Acceleration of muscle regeneration by local injection of muscle-specific microRNAs in rat skeletal muscle injury model.	Nakasa T, etal., J Cell Mol Med. 2010 Oct;14(10):2495-505. doi: 10.1111/j.1582-4934.2009.00898.x.
8.	Satellite cell proliferation is reduced in muscles of obese Zucker rats but restored with loading.	Peterson JM, etal., Am J Physiol Cell Physiol. 2008 Aug;295(2):C521-8. Epub 2008 May 28.
9.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Growth hormone attenuates skeletal muscle changes in experimental chronic heart failure.	Santos DP, etal., Growth Horm IGF Res. 2010 Apr;20(2):149-55. doi: 10.1016/j.ghir.2009.11.007. Epub 2010 Jan 8.
12.	The skeletal muscle Wnt pathway may modulate insulin resistance and muscle development in a diet-induced obese rat model.	Zhou D, etal., Obesity (Silver Spring). 2012 Aug;20(8):1577-84. doi: 10.1038/oby.2012.42. Epub 2012 Feb 21.

Additional References at PubMed

PMID:1303276	PMID:1309507	PMID:1311614	PMID:1315077	PMID:1324843	PMID:1330322	PMID:1347472	PMID:1348494	PMID:1374351	PMID:1406681	PMID:1618140	PMID:1618148
PMID:1652425	PMID:1668275	PMID:1673668	PMID:1754380	PMID:1846704	PMID:1850513	PMID:1911647	PMID:1970795	PMID:1981054	PMID:1989904	PMID:2045411	PMID:2176177
PMID:2315312	PMID:2503252	PMID:2552320	PMID:2748593	PMID:3175662	PMID:3286015	PMID:3690668	PMID:7532173	PMID:7556922	PMID:7588068	PMID:7589813	PMID:7590262
PMID:7601470	PMID:7607707	PMID:7659522	PMID:7698755	PMID:7720554	PMID:7720572	PMID:7720708	PMID:7787235	PMID:7797078	PMID:7824267	PMID:7835903	PMID:7863329
PMID:7929574	PMID:7940021	PMID:7973707	PMID:8001787	PMID:8020965	PMID:8026334	PMID:8034307	PMID:8035824	PMID:8076526	PMID:8095242	PMID:8095339	PMID:8125164
PMID:8136524	PMID:8162858	PMID:8181063	PMID:8269513	PMID:8288260	PMID:8294401	PMID:8383334	PMID:8393145	PMID:8400402	PMID:8404542	PMID:8421497	PMID:8452817
PMID:8482411	PMID:8565825	PMID:8565855	PMID:8573720	PMID:8575308	PMID:8587605	PMID:8601493	PMID:8601494	PMID:8617206	PMID:8627340	PMID:8631261	PMID:8633043
PMID:8675005	PMID:8681797	PMID:8759016	PMID:8797820	PMID:8812484	PMID:8837770	PMID:8866021	PMID:8901056	PMID:8903733	PMID:8950513	PMID:8999959	PMID:9011744
PMID:9029156	PMID:9039266	PMID:9050988	PMID:9060416	PMID:9061445	PMID:9076685	PMID:9094721	PMID:9106663	PMID:9118475	PMID:9172305	PMID:9184158	PMID:9216993
PMID:9226440	PMID:9234731	PMID:9268575	PMID:9284043	PMID:9284044	PMID:9343420	PMID:9344650	PMID:9359635	PMID:9368741	PMID:9374397	PMID:9382869	PMID:9407021
PMID:9428409	PMID:9438383	PMID:9488722	PMID:9520323	PMID:9525963	PMID:9528857	PMID:9585504	PMID:9609818	PMID:9659901	PMID:9664688	PMID:9808779	PMID:9811581
PMID:9833687	PMID:9874799	PMID:9986734	PMID:10037786	PMID:10072440	PMID:10075840	PMID:10075844	PMID:10079229	PMID:10199981	PMID:10208749	PMID:10322110	PMID:10349636
PMID:10357902	PMID:10392718	PMID:10403250	PMID:10439029	PMID:10457014	PMID:10508520	PMID:10512192	PMID:10556048	PMID:10590474	PMID:10603349	PMID:10603357	PMID:10635459
PMID:10652346	PMID:10656756	PMID:10669094	PMID:10694423	PMID:10725239	PMID:10733231	PMID:10751147	PMID:10794165	PMID:10804168	PMID:10926754	PMID:10974667	PMID:10985858
PMID:11036096	PMID:11042159	PMID:11044626	PMID:11060232	PMID:11066097	PMID:11076861	PMID:11171399	PMID:11201041	PMID:11217851	PMID:11285237	PMID:11447261	PMID:11455436
PMID:11458388	PMID:11493522	PMID:11525743	PMID:11532390	PMID:11562355	PMID:11570822	PMID:11684023	PMID:11700944	PMID:11711431	PMID:11714687	PMID:11718554	PMID:11784080
PMID:11809751	PMID:11819203	PMID:11839816	PMID:11931766	PMID:11940648	PMID:11969267	PMID:12015303	PMID:12023284	PMID:12032356	PMID:12037571	PMID:12037670	PMID:12115029
PMID:12135755	PMID:12162885	PMID:12167713	PMID:12184991	PMID:12242286	PMID:12244043	PMID:12372284	PMID:12415271	PMID:12421714	PMID:12427866	PMID:12441290	PMID:12441295
PMID:12466851	PMID:12477932	PMID:12485625	PMID:12486129	PMID:12493912	PMID:12619134	PMID:12657651	PMID:12665587	PMID:12668636	PMID:12694204	PMID:12705871	PMID:12782625
PMID:12798290	PMID:12802082	PMID:12812790	PMID:12832540	PMID:12861012	PMID:12878168	PMID:12887892	PMID:12895031	PMID:12941952	PMID:12948444	PMID:14499644	PMID:14504233
PMID:14517256	PMID:14595115	PMID:14623241	PMID:14660660	PMID:14667415	PMID:14681479	PMID:14706073	PMID:14732408	PMID:14749395	PMID:14754880	PMID:14762206	PMID:14769817
PMID:15020674	PMID:15075292	PMID:15132998	PMID:15138500	PMID:15149596	PMID:15169898	PMID:15173318	PMID:15183306	PMID:15189813	PMID:15192231	PMID:15233999	PMID:15254975
PMID:15282310	PMID:15286803	PMID:15351717	PMID:15366017	PMID:15366018	PMID:15376315	PMID:15385444	PMID:15386014	PMID:15466486	PMID:15489287	PMID:15497153	PMID:15520228
PMID:15531760	PMID:15563453	PMID:15568017	PMID:15572127	PMID:15604102	PMID:15618518	PMID:15634692	PMID:15653949	PMID:15706034	PMID:15719023	PMID:15729689	PMID:15739233
PMID:15743821	PMID:15746098	PMID:15788460	PMID:15804569	PMID:15843801	PMID:15844178	PMID:15857912	PMID:15870273	PMID:15888449	PMID:15890200	PMID:15937819	PMID:15964993
PMID:16007160	PMID:16007210	PMID:16024790	PMID:16040801	PMID:16129691	PMID:16141072	PMID:16141073	PMID:16166380	PMID:16183241	PMID:16193506	PMID:16208536	PMID:16219688
PMID:16245309	PMID:16267055	PMID:16275751	PMID:16323077	PMID:16368089	PMID:16387292	PMID:16405903	PMID:16424906	PMID:16437161	PMID:16452092	PMID:16461349	PMID:16500621
PMID:16584724	PMID:16598734	PMID:16638982	PMID:16705021	PMID:16797743	PMID:16847330	PMID:16858404	PMID:16901893	PMID:16951257	PMID:16952014	PMID:17011493	PMID:17028574
PMID:17030984	PMID:17043109	PMID:17098221	PMID:17107996	PMID:17111365	PMID:17138667	PMID:17166778	PMID:17194759	PMID:17275805	PMID:17289022	PMID:17295338	PMID:17330803
PMID:17331176	PMID:17352741	PMID:17360543	PMID:17377068	PMID:17384148	PMID:17428829	PMID:17436272	PMID:17477400	PMID:17487425	PMID:17506979	PMID:17540357	PMID:17553906
PMID:17569791	PMID:17592144	PMID:17652354	PMID:17684061	PMID:17693064	PMID:17761773	PMID:17785180	PMID:17855775	PMID:17875930	PMID:17881575	PMID:17904117	PMID:17919536
PMID:17932502	PMID:17940048	PMID:17940050	PMID:17959144	PMID:17961534	PMID:17965412	PMID:18047787	PMID:18065432	PMID:18078839	PMID:18215268	PMID:18243171	PMID:18253507
PMID:18255059	PMID:18287559	PMID:18316399	PMID:18331721	PMID:18334251	PMID:18367555	PMID:18415939	PMID:18424556	PMID:18442487	PMID:18511457	PMID:18513743	PMID:18557763
PMID:18593883	PMID:18619954	PMID:18676376	PMID:18676817	PMID:18719582	PMID:18795097	PMID:18816441	PMID:18816853	PMID:18816858	PMID:18820033	PMID:18836078	PMID:18851836
PMID:18854138	PMID:19073597	PMID:19121967	PMID:19123137	PMID:19129464	PMID:19165827	PMID:19198652	PMID:19223199	PMID:19229108	PMID:19269978	PMID:19303854	PMID:19304887
PMID:19319192	PMID:19346403	PMID:19384958	PMID:19443691	PMID:19460349	PMID:19464281	PMID:19520072	PMID:19521566	PMID:19531352	PMID:19553684	PMID:19641492	PMID:19646513
PMID:19698141	PMID:19712265	PMID:19723804	PMID:19796622	PMID:19801895	PMID:19812254	PMID:19818710	PMID:19835856	PMID:19943111	PMID:19956724	PMID:20005263	PMID:20013826
PMID:20045680	PMID:20048262	PMID:20059953	PMID:20059958	PMID:20063414	PMID:20069545	PMID:20124407	PMID:20130207	PMID:20139084	PMID:20211142	PMID:20307260	PMID:20334626
PMID:20399744	PMID:20412779	PMID:20412780	PMID:20412781	PMID:20458750	PMID:20466877	PMID:20503368	PMID:20534536	PMID:20544915	PMID:20833138	PMID:20881014	PMID:20940258
PMID:20948544	PMID:20956306	PMID:20956382	PMID:20956524	PMID:20978076	PMID:21035439	PMID:21041476	PMID:21078671	PMID:21127072	PMID:21131290	PMID:21143873	PMID:21177349
PMID:21211521	PMID:21212806	PMID:21254332	PMID:21256960	PMID:21267068	PMID:21288905	PMID:21305318	PMID:21339173	PMID:21397010	PMID:21422169	PMID:21425413	PMID:21454680
PMID:21478499	PMID:21512107	PMID:21556048	PMID:21683695	PMID:21689628	PMID:21708977	PMID:21731673	PMID:21741963	PMID:21782525	PMID:21832073	PMID:21852201	PMID:21873635
PMID:21936881	PMID:21985497	PMID:21989910	PMID:22068056	PMID:22076929	PMID:22079119	PMID:22147266	PMID:22174917	PMID:22192089	PMID:22210883	PMID:22215600	PMID:22228095
PMID:22242125	PMID:22279050	PMID:22298038	PMID:22315423	PMID:22318627	PMID:22333916	PMID:22351927	PMID:22358842	PMID:22362755	PMID:22431088	PMID:22438570	PMID:22460713
PMID:22522309	PMID:22569126	PMID:22613845	PMID:22621191	PMID:22638570	PMID:22666383	PMID:22673621	PMID:22723526	PMID:22723710	PMID:22736793	PMID:22740650	PMID:22768305
PMID:22771117	PMID:22819676	PMID:22848585	PMID:22859371	PMID:22940113	PMID:22983009	PMID:22987639	PMID:22987640	PMID:23034633	PMID:23079662	PMID:23112163	PMID:23192345
PMID:23249738	PMID:23266826	PMID:23406902	PMID:23438194	PMID:23460641	PMID:23477786	PMID:23650549	PMID:23671652	PMID:23717575	PMID:23785297	PMID:23794713	PMID:23840772
PMID:23868259	PMID:23907538	PMID:23928680	PMID:23933088	PMID:23946446	PMID:23969310	PMID:23987512	PMID:23993744	PMID:24019467	PMID:24055173	PMID:24056763	PMID:24074615
PMID:24092238	PMID:24239359	PMID:24301466	PMID:24349514	PMID:24357723	PMID:24361185	PMID:24394376	PMID:24440912	PMID:24472550	PMID:24613379	PMID:24671706	PMID:24703692
PMID:24703953	PMID:24705356	PMID:24742196	PMID:24760765	PMID:24844572	PMID:24912677	PMID:24924195	PMID:24927569	PMID:24942009	PMID:24972797	PMID:25002401	PMID:25005473
PMID:25006242	PMID:25055037	PMID:25069613	PMID:25085416	PMID:25087979	PMID:25111334	PMID:25130140	PMID:25197048	PMID:25217815	PMID:25220152	PMID:25224227	PMID:25236433
PMID:25329411	PMID:25403490	PMID:25452432	PMID:25482443	PMID:25490265	PMID:25490270	PMID:25534856	PMID:25605943	PMID:25640239	PMID:25686699	PMID:25715398	PMID:25737281
PMID:25774500	PMID:25801030	PMID:25807280	PMID:25848030	PMID:26042028	PMID:26074812	PMID:26149774	PMID:26229056	PMID:26238020	PMID:26275053	PMID:26334330	PMID:26387456
PMID:26387956	PMID:26393505	PMID:26468207	PMID:26468276	PMID:26499038	PMID:26562264	PMID:26658965	PMID:26669898	PMID:26688546	PMID:26801181	PMID:26839363	PMID:26880551
PMID:26881702	PMID:26902638	PMID:26906734	PMID:26951610	PMID:26954549	PMID:26963625	PMID:26969076	PMID:27120339	PMID:27166947	PMID:27185876	PMID:27302134	PMID:27349543
PMID:27491074	PMID:27705798	PMID:27743478	PMID:27798115	PMID:27823936	PMID:27880908	PMID:27906130	PMID:27920252	PMID:27930960	PMID:27977683	PMID:27993983	PMID:28091529
PMID:28117277	PMID:28118982	PMID:28228264	PMID:28286175	PMID:28336234	PMID:28351977	PMID:28438836	PMID:28569745	PMID:28600496	PMID:28607151	PMID:28607928	PMID:28609469
PMID:28637957	PMID:28827394	PMID:28865032	PMID:28878038	PMID:28918507	PMID:28919111	PMID:28927261	PMID:28956216	PMID:28973166	PMID:28981706	PMID:28982687	PMID:29073096
PMID:29084951	PMID:29097153	PMID:29158520	PMID:29166613	PMID:29187383	PMID:29231808	PMID:29241530	PMID:29273440	PMID:29316425	PMID:29328071	PMID:29343749	PMID:29364044
PMID:29396429	PMID:29449644	PMID:29478898	PMID:29483576	PMID:29543863	PMID:29555813	PMID:29679560	PMID:29768404	PMID:29882512	PMID:30016497	PMID:30037979	PMID:30081710
PMID:30206360	PMID:30216109	PMID:30225906	PMID:30237319	PMID:30389854	PMID:30415659	PMID:30429366	PMID:30511745	PMID:30568302	PMID:30683662	PMID:30789342	PMID:30791960
PMID:30858352	PMID:30862660	PMID:30872276	PMID:30964448	PMID:30979776	PMID:30996264	PMID:31138662	PMID:31353205	PMID:31393265	PMID:31433978	PMID:31519520	PMID:31519691
PMID:31535973	PMID:31591561	PMID:31597102	PMID:31647919	PMID:31685980	PMID:31693883	PMID:31719045	PMID:31736098	PMID:31857580	PMID:32014863	PMID:32039917	PMID:32051546
PMID:32094117	PMID:32160556	PMID:32193486	PMID:32231311	PMID:32314958	PMID:32520726	PMID:32768399	PMID:33093635	PMID:33201874	PMID:33298461	PMID:33347679	PMID:33482080
PMID:33504650	PMID:33527775	PMID:33527978	PMID:33637744	PMID:33704409	PMID:33735101	PMID:33749882	PMID:33836079	PMID:34011940	PMID:34078746	PMID:34124052	PMID:34158500
PMID:34325487	PMID:34553752	PMID:34590686	PMID:34617961	PMID:34906895	PMID:35017543	PMID:35149920	PMID:35225230	PMID:35618700	PMID:35733999	PMID:35806430	PMID:35874842
PMID:35944701	PMID:36043912	PMID:36154712	PMID:36200826	PMID:36227576	PMID:36400788	PMID:36542062	PMID:36739949	PMID:36743919	PMID:36825984	PMID:36982919	PMID:36994104
PMID:37174683	PMID:37244931	PMID:37246520	PMID:37250337	PMID:37267426	PMID:37272529	PMID:37681900	PMID:37683043	PMID:37703038	PMID:37723138	PMID:37851578	PMID:37883229
PMID:37976157	PMID:38036537	PMID:38295182	PMID:38412099	PMID:38514795	PMID:38690566	PMID:38875306	PMID:39082789

Genomics

Comparative Map Data

Myod1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	46,025,898 - 46,028,523 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	46,376,474 - 46,379,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	53,631,844 - 53,634,462 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	46,244,524 - 46,247,137 (+)	NCBI		MGSCv36	mm8
Celera	7	41,849,969 - 41,852,587 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	30.03	NCBI

MYOD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	17,719,571 - 17,722,136 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	17,719,571 - 17,722,136 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	17,741,118 - 17,743,683 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	17,697,686 - 17,700,254 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	17,697,734 - 17,700,254	NCBI
Celera	11	17,873,623 - 17,876,191 (+)	NCBI		Celera
Cytogenetic Map	11	p15.1	NCBI
HuRef	11	17,425,110 - 17,427,678 (+)	NCBI		HuRef
CHM1_1	11	17,740,837 - 17,743,405 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	17,817,261 - 17,819,826 (+)	NCBI		T2T-CHM13v2.0

Myod1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	106,021,161 - 106,023,871 (+)	NCBI		GRCr8
mRatBN7.2	1	96,884,864 - 96,887,574 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	96,884,948 - 96,887,554 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	102,270,899 - 102,273,609 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	110,742,884 - 110,745,594 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	104,033,260 - 104,035,970 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	102,396,538 - 102,399,248 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	102,396,538 - 102,399,248 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	103,481,604 - 103,484,314 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	96,910,190 - 96,912,900 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	96,988,300 - 96,991,011 (+)	NCBI
Celera	1	91,133,211 - 91,135,921 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

Myod1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	32,523,924 - 32,526,674 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	32,523,959 - 32,526,575 (+)	NCBI	ChiLan1.0	ChiLan1.0

MYOD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	20,051,315 - 20,053,878 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	20,011,813 - 20,014,376 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	17,772,317 - 17,774,884 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	17,456,124 - 17,458,690 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	17,456,124 - 17,458,690 (+)	Ensembl	panpan1.1		panPan2

MYOD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	40,257,792 - 40,260,461 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	40,258,027 - 40,259,712 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	39,757,431 - 39,759,334 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	41,362,253 - 41,364,156 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	41,362,471 - 41,364,912 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	40,375,120 - 40,377,023 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	40,582,881 - 40,584,784 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	40,921,445 - 40,923,349 (+)	NCBI		UU_Cfam_GSD_1.0

Myod1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	45,372,988 - 45,375,811 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936528	1,407,661 - 1,409,573 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936528	1,407,187 - 1,409,683 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYOD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	41,415,775 - 41,424,435 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	41,422,522 - 41,424,236 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	44,483,015 - 44,484,730 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103239432
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	47,250,927 - 47,254,572 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	47,251,551 - 47,253,284 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	144,644,005 - 144,646,580 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Myod1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	9,345,613 - 9,347,326 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624766	9,345,390 - 9,347,985 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	444
Count of miRNA genes:	314
Interacting mature miRNAs:	347
Transcripts:	ENSMUST00000072514
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25314307	Mlh1fc2_m	MLH1 foci count 2 (mouse)					7	6502999	133501729	Mouse
4141566	Femwf8_m	femur work to failure 8 (mouse)			Not determined			13032485	47032621	Mouse
1301969	Lbw5_m	lupus NZB x NZW 5 (mouse)			Not determined		7	26847615	60851775	Mouse
38501071	Stsl6_m	Salmonella typhimurium susceptibility locus 6 (mouse)					7	34199425	51149748	Mouse
1357586	Mdmsc3_m	modifier of muscularity 3 (mouse)			Not determined		7	34447869	68448018	Mouse
38501068	Tip1_m	tuberculosis immunophenotype 1, spleen CFU (mouse)					7	3602999	72549748	Mouse
39128210	Lwq19_m	liver weight QTL 19 (mouse)					7	33497727	58148965	Mouse
11252140	Fdr1_m	fat response to dietary restriction 1 (mouse)					7	41148820	75148965	Mouse
25314314	Sccor1_m	synaptonemal complex length to mean MLH1 count ratio 1 (mouse)					7	13333925	47349748	Mouse
1357469	Kidq5_m	kidney weight QTL 5 (mouse)			Not determined		7	33497727	58148965	Mouse
1301082	Bbaa16_m	B.burgdorferi-associated arthritis 16 (mouse)			Not determined		7	36280015	116416877	Mouse
4142003	W3q10_m	weight 3 weeks QTL 10 (mouse)			Not determined			33497727	58148965	Mouse
12790989	Tgl6_m	triglyceride 6 (mouse)					7	27540549	61540549	Mouse
1559000	Ossc1_m	osteosarcoma susceptibility 1 (mouse)			Not determined		7	34053025	68053223	Mouse
10043926	Bw1n_m	body weight 1 in NSY (mouse)			Not determined		7	45161966	118693530	Mouse
11522751	Cocia17_m	cocaine-induced activity, QTL 17 (mouse)					7	13135204	47135204	Mouse
12792978	Fbmd3_m	femoral bone mineral density 3, females only (mouse)					7	7050288	142367832	Mouse
4141805	Sle19_m	systematic lupus erythematosus susceptibility 19 (mouse)			Not determined			30032485	81135653	Mouse
1357634	Splq7_m	spleen weight QTL 7 (mouse)			Not determined		7	33497727	58148965	Mouse
4141929	Chlq18_m	circulating hormone level QTL 18 (mouse)			Not determined		7	41148820	75148965	Mouse
1300996	Aorls2_m	aortic lesion size 2 (mouse)			Not determined		7	32394532	66394681	Mouse
10449158	Eosn3_m	eosinophil differential 3 (mouse)					7	12480877	46480877	Mouse
1301514	Rigs1_m	radiation induced gastroschisis 1 (mouse)			Not determined		7	36280015	92394346	Mouse
1300878	Skts1_m	skin tumor susceptibility 1 (mouse)			Not determined		7	37891386	71891582	Mouse
1301709	Bdt4_m	bone density traits 4 (mouse)			Not determined		7	22888572	56888716	Mouse
1300722	Sle3_m	systemic lupus erythmatosus susceptibility 3 (mouse)			Not determined		7	3511728	87142720	Mouse
12904742	Litsq2_m	litter size QTL 2 (mouse)					7	22673887	56674033	Mouse
1301175	Ap7q_m	alcohol preference 7 QTL (mouse)			Not determined		7	31714845	65715077	Mouse
1300791	Abbp3_m	A/J and C57BL/6 blood pressure 3 (mouse)			Not determined		7	39673887	103510010	Mouse
1301622	Eae12_m	susceptibility to experimental allergic encephalomyelitis 12 (mouse)			Not determined		7	19280015	53280104	Mouse
11354952	Pdcc1_m	plasmacytoid dentritic cell compartment 1 (mouse)					7	23066531	57066531	Mouse
12880417	V125Dq5_m	vitamin D active form serum level QTL 5 (mouse)					7	45249748	79249748	Mouse
10402488	Dipa2_m	drug induced psychomotor activation 2 (mouse)			Not determined		7	38421548	72421684	Mouse
4142102	Tailq5_m	tail length QTL 5 (mouse)			Not determined			33497727	58148965	Mouse
4141909	W10q18_m	weight 10 weeks QTL 18 (mouse)			Not determined			33497727	58148965	Mouse
10449139	Eosn1_m	eosinophil differential 1 (mouse)					7	12480877	46480877	Mouse
26884404	Huml1_m	humerus length 1, 5 week (mouse)					7	30199425	108999207	Mouse
1301052	Bhr6_m	bronchial hyperresponsiveness 6 (mouse)			Not determined		7	19842250	53842367	Mouse
1357883	Epfq5_m	epididymal fat pad weight QTL 5 (mouse)			Not determined		7	33497727	58148965	Mouse
10045622	Heal20_m	wound healing/regeneration 20 (mouse)			Not determined		7	34316887	68317043	Mouse
1301158	Eae4_m	susceptibility to experimental allergic encephalomyelitis 4 (mouse)			Not determined		7	19147398	141919804	Mouse
4142218	W6q17_m	weight 6 weeks QTL 17 (mouse)			Not determined			33497727	58148965	Mouse
10412199	Sst2_m	susceptibility to tuberculosis 2 (mouse)			Not determined		7	18728794	119485380	Mouse
25314303	Vmm4_m	variable multisystem mineralization 4, kidney (mouse)					7	37299425	87049208	Mouse
1559016	Drsi_m	DCC-related Spp1 induction (mouse)			Not determined		7	16637293	49159331	Mouse
25314301	Vmm3_m	variable multisystem mineralization 3, lung (mouse)					7	37299425	72049748	Mouse

Markers in Region

AI503393

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,759 - 46,378,877	UniSTS	GRCm38
MGSCv37	7	53,634,129 - 53,634,247	UniSTS	GRCm37
Celera	7	41,852,254 - 41,852,372	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS
Whitehead/MRC_RH	7	580.96	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
MGSCv37	7	53,632,524 - 53,633,777	UniSTS	GRCm37
MGSCv37	7	53,632,522 - 53,633,777	UniSTS	GRCm37
MGSCv37	7	53,631,861 - 53,632,250	UniSTS	GRCm37
Celera	7	41,849,986 - 41,850,375	UniSTS
Celera	7	41,850,649 - 41,851,902	UniSTS
Celera	7	41,850,647 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS
cM Map	7	23.5	UniSTS

PMC133998P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,038 - 46,377,806	UniSTS	GRCm38
MGSCv37	7	53,632,408 - 53,633,176	UniSTS	GRCm37
Celera	7	41,850,533 - 41,851,301	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC151607P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,761 - 46,379,087	UniSTS	GRCm38
MGSCv37	7	53,634,131 - 53,634,457	UniSTS	GRCm37
Celera	7	41,852,256 - 41,852,582	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC162217P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,487 - 46,379,008	UniSTS	GRCm38
MGSCv37	7	53,633,857 - 53,634,378	UniSTS	GRCm37
Celera	7	41,851,982 - 41,852,503	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC86965P5

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,376,360 - 46,376,514	UniSTS	GRCm38
MGSCv37	7	53,631,730 - 53,631,884	UniSTS	GRCm37
Celera	7	41,849,855 - 41,850,009	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	B4	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,152 - 46,378,407	UniSTS	GRCm38
MGSCv37	7	53,632,522 - 53,633,777	UniSTS	GRCm37
Celera	7	41,850,647 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,376,491 - 46,376,880	UniSTS	GRCm38
MGSCv37	7	53,631,861 - 53,632,250	UniSTS	GRCm37
Celera	7	41,849,986 - 41,850,375	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,154 - 46,378,407	UniSTS	GRCm38
MGSCv37	7	53,632,524 - 53,633,777	UniSTS	GRCm37
Celera	7	41,850,649 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_010866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC020786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK076157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK142859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M18779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M84918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X61655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000072514 ⟹ ENSMUSP00000072330

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	46,025,898 - 46,028,523 (+)	Ensembl
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl

RefSeq Acc Id:

NM_010866 ⟹ NP_034996

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI
GRCm38	7	46,376,474 - 46,379,092 (+)	ENTREZGENE
MGSCv37	7	53,631,844 - 53,634,462 (+)	RGD
Celera	7	41,849,969 - 41,852,587 (+)	RGD
cM Map	7		ENTREZGENE

Sequence:

show sequence

AGGGGCCAGGACGCCCCAGGACACGACTGCTTTCTTCACCACTCCTCTGACAGGACAGGACAGG
GAGGAGGGGTAGAGGACAGCCGGTGTGCATTCCAACCCACAGAACCTTTGTCATTGTACTGTTG
GGGTTCCGGAGTGGCAGAAAGTTAAGACGACTCTCACGGCTTGGGTTGAGGCTGGACCCAGGAA
CTGGGATATGGAGCTTCTATCGCCGCCACTCCGGGACATAGACTTGACAGGCCCCGACGGCTCT
CTCTGCTCCTTTGAGACAGCAGACGACTTCTATGATGACCCGTGTTTCGACTCACCAGACCTGC
GCTTTTTTGAGGACCTGGACCCGCGCCTGGTGCACATGGGAGCCCTCCTGAAACCGGAGGAGCA
CGCACACTTCCCTACTGCGGTGCACCCAGGCCCAGGCGCTCGTGAGGATGAGCATGTGCGCGCG
CCCAGCGGGCACCACCAGGCGGGTCGCTGCTTGCTGTGGGCCTGCAAGGCGTGCAAGCGCAAGA
CCACCAACGCTGATCGCCGCAAGGCCGCCACCATGCGCGAGCGCCGCCGCCTGAGCAAAGTGAA
TGAGGCCTTCGAGACGCTCAAGCGCTGCACGTCCAGCAACCCGAACCAGCGGCTACCCAAGGTG
GAGATCCTGCGCAACGCCATCCGCTACATCGAAGGTCTGCAGGCTCTGCTGCGCGACCAGGACG
CCGCGCCCCCTGGCGCCGCTGCCTTCTACGCACCTGGACCGCTGCCCCCAGGCCGTGGCAGCGA
GCACTACAGTGGCGACTCAGATGCATCCAGCCCGCGCTCCAACTGCTCTGATGGCATGATGGAT
TACAGCGGCCCCCCAAGCGGCCCCCGGCGGCAGAATGGCTACGACACCGCCTACTACAGTGAGG
CGGCGCGCGAGTCCAGGCCAGGGAAGAGTGCGGCTGTGTCGAGCCTCGACTGCCTGTCCAGCAT
AGTGGAGCGCATCTCCACAGACAGCCCCGCTGCGCCTGCGCTGCTTTTGGCAGATGCACCACCA
GAGTCGCCTCCGGGTCCGCCAGAGGGGGCATCCCTAAGCGACACAGAACAGGGAACCCAGACCC
CGTCTCCCGACGCCGCCCCTCAGTGTCCTGCAGGCTCAAACCCCAATGCGATTTATCAGGTGCT
TTGAGAGATCGACTGCAGCAGCAGAGGGCGCACCACCGTAGGCACTCCTGGGGATGGTGTCCCT
GGTTCTTCACGCCCAAAAGATGAAGCTTAAATGACACTCTTCCCAACTGTCCTTTCGAAGCCGT
TCTTCCAGAGGGAAGGGAAGAGCAGAAGTCTGTCCTAGATCCAGCCCCAAAGAAAGGACATAGT
CCTTTTTGTTGTTGTTGTTGTAGTCCTTCAGTTGTTTGTTTGTTTTTTCATGCGGCTCACAGCG
AAGGCCACTTGCACTCTGGCTGCACCTCACTGGGCCAGAGCTGATCCTTGAGTGGCCAGGCGCT
CTTCCTTTCCTCATAGCACAGGGGTGAGCCTTGCACACCTAAGCCCTGCCCTCCACATCCTTTT
GTTTGTCACTTTCTGGAGCCCTCCTGGCACCCACTTTTCCCCACAGCTTGCGGAGGCCACTCAG
GTCTCAGGTGTAACAGGTGTAACCATACCCCACTCTCCCCCTTCCCGCGGTTCAGGACCACTTA
TTTTTTTATATAAGACTTTTGTAATCTATTCGTGTAAATAAGAGTTGCTTGGCCAGAGCGGGAG
CCCCTTGGGCTATATTTATCTCCCAGGCATGCTGTGTAGTGCAACAAAAACTTTGTATGTTTAT
TCCTCAAGCGGGCGAGCCTCGAGGCTCGCTCGCTCAGGTGTTGGAAATAAAGACGCTAATTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_034996	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA39798	(Get FASTA)	NCBI Sequence Viewer
	AAA39799	(Get FASTA)	NCBI Sequence Viewer
	AAI03614	(Get FASTA)	NCBI Sequence Viewer
	AAI03619	(Get FASTA)	NCBI Sequence Viewer
	AAI03620	(Get FASTA)	NCBI Sequence Viewer
	BAC36224	(Get FASTA)	NCBI Sequence Viewer
	BAE25213	(Get FASTA)	NCBI Sequence Viewer
	CAA43836	(Get FASTA)	NCBI Sequence Viewer
	EDL22927	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000072330
	ENSMUSP00000072330.2
GenBank Protein	P10085	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_034996 ⟸ NM_010866

- UniProtKB:

Q8C6B1 (UniProtKB/Swiss-Prot), P10085 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAH
FPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEA
FETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHY
SGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVE
RISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL

hide sequence

Ensembl Acc Id:

ENSMUSP00000072330 ⟸ ENSMUST00000072514

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10085-F1-model_v2	AlphaFold	P10085	1-318	view protein structure

Promoters

RGD ID:

8664121

Promoter ID:

EPDNEW_M10091

Type:

multiple initiation site

Name:

Myod1_1

Description:

Mus musculus myogenic differentiation 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	46,376,474 - 46,376,534	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97275	AgrOrtholog
Ensembl Genes	ENSMUSG00000009471	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000072514	ENTREZGENE
	ENSMUST00000072514.3	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
InterPro	Basic	UniProtKB/Swiss-Prot
	bHLH_dom	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
	Myf5	UniProtKB/Swiss-Prot
	Myogenic_factor	UniProtKB/Swiss-Prot
KEGG Report	mmu:17927	UniProtKB/Swiss-Prot
MGD	MGI:97275	ENTREZGENE
NCBI Gene	17927	ENTREZGENE
PANTHER	MYOBLAST DETERMINATION PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR11534	UniProtKB/Swiss-Prot
Pfam	Basic	UniProtKB/Swiss-Prot
	HLH	UniProtKB/Swiss-Prot
	Myf5	UniProtKB/Swiss-Prot
PhenoGen	Myod1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
SMART	BASIC	UniProtKB/Swiss-Prot
	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
UniProt	MYOD1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8C6B1	ENTREZGENE
UniProt Secondary	Q8C6B1	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype